DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG17475

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:287 Identity:77/287 - (26%)
Similarity:123/287 - (42%) Gaps:38/287 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 TCYFVRFDHYVCCAPAVAPI-VTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAA 148
            |||              .|| ..|.:|.:.::|..:||.:.:: |...|:.|...:..|..:..:
  Fly    17 TCY--------------KPISAVRLAQLSEDQLEWISKAEGVN-FQNRVINGEDVQLGEAKYQIS 66

  Fly   149 LGWRSNFDQRIY--YRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDI-SIRRV 210
            |       |.:|  :.|||.:|....|||||||  :.|..|:.:|:....:...:.:.: .:...
  Fly    67 L-------QGMYGGHICGGCIIDERHVLTAAHC--VYGYNPTYLRVITGTVEYEKPDAVYFVEEH 122

  Fly   211 IIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLL 273
            .||.:|::...:|||||:.|....|  ...:|..:.|......|.:...|:|.|...|.:...|.
  Fly   123 WIHCNYNSPDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQ 187

  Fly   274 KVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITS 338
            |..|..|....||.....|. :.|  ...:|. ..||.:..|.|||||||...    |.:.|:.:
  Fly   188 KAYLTHVVYSTCQEIMNNDP-SNG--PCHICT-LTTGGQGACHGDSGGPLTHN----GVLYGLVN 244

  Fly   339 LGQGCASGPPSVYTRVSSFVDWIEGIV 365
            .|..||.|.|..:..|..:::||..::
  Fly   245 WGYPCALGVPDSHANVYYYLEWIRSMI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 3/12 (25%)
Tryp_SPc 132..364 CDD:238113 66/236 (28%)
Tryp_SPc 132..361 CDD:214473 64/233 (27%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 64/234 (27%)
Tryp_SPc 50..269 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437649
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.