DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG31265

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:204 Identity:61/204 - (29%)
Similarity:93/204 - (45%) Gaps:13/204 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 YRCGGALIANNFVLTAAHCADLGGEPPSQVR-LGGDNLTLTEGEDISIRRVIIHPDYSASTAYND 224
            :.||||::..|:::||.||.:  ...|:.|. :.|.|.....|.......:..|..|.....:||
  Fly    61 HNCGGAILNENWIITAGHCVE--NFIPALVNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHND 123

  Fly   225 IALLEL-ETAAKPEL-KPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQH 287
            |||::| |.....|| :|..:.|:.......:...|:|.....|.|...|.|:.:..|..:||..
  Fly   124 IALVKLTENITFNELTQPIALPTRPVQLGEEIVLTGWGSDVAYGSSMEDLHKLTVGLVPLDECYE 188

  Fly   288 HYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYT 352
            .:.:.. :.||  ..:|.....|| ..|.|||||||:..    |.:||:.:.|:.|..|.|.|..
  Fly   189 TFNRTS-SMGV--GHICTFSREGE-GACHGDSGGPLVSN----GQLVGVVNWGRPCGVGLPDVQA 245

  Fly   353 RVSSFVDWI 361
            .|..::|||
  Fly   246 NVYYYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 61/204 (30%)
Tryp_SPc 132..361 CDD:214473 59/202 (29%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 59/202 (29%)
Tryp_SPc 39..257 CDD:238113 61/204 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.