DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG9649

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:400 Identity:102/400 - (25%)
Similarity:174/400 - (43%) Gaps:72/400 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 TRVYL-HLLLVSLPLLAV-------HATPAISPQSLRGIIFPVETFDECQLEDVARTKGTCR--- 64
            ||:.| ..|..|:||.|:       |..|. :||:...:.     .:|.:.|.|.|.:...|   
  Fly   132 TRLSLSRTLRTSVPLAAIPPSQRTDHQWPQ-APQTNYTVY-----EEEEEEEPVQRRRPQQRPSR 190

  Fly    65 -RMEDCPS--ALNGWLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSS-----QQACNELNKV-S 120
             |.:..||  .|....:..:.|        :......|:|.|..|.:.     .|...:|:.: .
  Fly   191 PRPQQAPSRPRLQPVPQLPQEP--------EFQTSARPSVHPSNTPAQASKFYPQTIGQLSGICG 247

  Fly   121 KVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQ--RIY-YRCGGALIANNFVLTAAHCADL 182
            :.|.|...|:.  .|:.....:.|:||||     |:.  |.| :.|||.||:...|::||||...
  Fly   248 REKVIQTPFIH--NGIEVERGQLPWMAAL-----FEHVGRDYNFLCGGTLISARTVISAAHCFRF 305

  Fly   183 GGEP-PSQ---VRLGGDNLTL-TEGEDISIRRVIIHPDYSASTAYN-DIALLELETAAK--PELK 239
            |... |.:   |.||.::|.| :.|..:.:.|::||..|:.:...: |:|||:|.....  ..:|
  Fly   306 GSRNLPGERTIVSLGRNSLDLFSSGATLGVARLLIHEQYNPNVYTDADLALLQLSNHVDIGDYIK 370

  Fly   240 PTCIWTQKEVTNTLVT--------AIGYGQTSFAGLSSAQLLKVPLKSVSNE-ECQHHYQKDQLA 295
            |.|:|.:    |.|:.        ..|:|:.. .|..:.:|.|:....:..: ||:.:..::. |
  Fly   371 PICLWNE----NFLLELPSGHKSYVAGWGEDE-KGNRNTRLAKMTDTDIITQWECRGNLSEEN-A 429

  Fly   296 QGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQ----GCASGPPSVYTRVSS 356
            :.:....:||.:.... ..|.|||||.|::|:..:..:.|:.|.||    .|....|.:||.|:.
  Fly   430 KFITSHTICASNAQAS-GPCSGDSGGGLMLQEQDIWMLRGVVSAGQRMTNRCNLTLPVIYTDVAK 493

  Fly   357 FVDWIEGIVW 366
            .::|:...:|
  Fly   494 HIEWLLSSMW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/52 (17%)
Tryp_SPc 132..364 CDD:238113 70/255 (27%)
Tryp_SPc 132..361 CDD:214473 69/252 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 69/254 (27%)
Tryp_SPc 259..497 CDD:214473 69/249 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437075
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.