DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG8870

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_731802.1 Gene:CG8870 / 41645 FlyBaseID:FBgn0038144 Length:356 Species:Drosophila melanogaster


Alignment Length:373 Identity:100/373 - (26%)
Similarity:158/373 - (42%) Gaps:95/373 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 LRGIIFPVETFDECQLEDVARTKGTCRRMEDCP---SALNGWLERRESPKTCYFVRFDHYVCCAP 99
            |:.|:.|......||.:.      .|..::.||   :.:|...:.....:.|    ..:.|||  
  Fly    13 LQIILVPYSNGAGCQFDT------ECVNLDKCPRTRAVMNSSRKNIIGLRRC----GTNKVCC-- 65

  Fly   100 AVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPR-----EFPFMAAL--GWRSNFDQ 157
              ....|......|.:..:                 .||:.:     |||:||.|  |.::|..|
  Fly    66 --PKWETYLPHDTCGQSRR-----------------KPTKGKIPALNEFPWMAMLLYGNKNNLSQ 111

  Fly   158 RIYYRCGGALIANNFVLTAAHCADLGGEPP--------SQVRLGGDNLT------LTEGE----- 203
            ::..:|||:||.|.:|||||||.    |.|        ..||||..|.:      :..|.     
  Fly   112 KLVPKCGGSLINNWYVLTAAHCV----EYPFMDYPYALKTVRLGEHNTSTNPDRAIVNGRRQYAP 172

  Fly   204 ---DISIRRVIIHPDYS-ASTAYNDIALLELETAAK--PELKPTCIWTQKEVT--NTLVTAIGY- 259
               :|.:.::|.|..:: .....|||||:.|:...:  ..::|.|:...:::.  .....|.|: 
  Fly   173 LYMEIEVDQIITHEQFNRGRRLINDIALVRLKFPVRYTRAIQPICLPRAQKLAAHKRKFQASGWP 237

  Fly   260 --GQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGP 322
              ||    |::|..||:..:.....:.|:.:|..:      ||:|:|||.:.| .||..||||||
  Fly   238 DMGQ----GIASEVLLRSFIAERHPDVCKSNYDFN------LGSQICAGGLDG-NDTSPGDSGGP 291

  Fly   323 LLMQDGLLG-----YVVGITSLGQ-GCA--SGPPSVYTRVSSFVDWIE 362
             ||:..:.|     |..||.|.|| .|.  :..|:.||:.|.|.:||:
  Fly   292 -LMETVIRGKVTLTYAAGIISYGQKPCVLKTCKPAFYTKTSYFFEWIK 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/49 (18%)
Tryp_SPc 132..364 CDD:238113 85/276 (31%)
Tryp_SPc 132..361 CDD:214473 83/273 (30%)
CG8870NP_731802.1 Tryp_SPc 93..340 CDD:238113 83/262 (32%)
Tryp_SPc 93..337 CDD:214473 81/259 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437422
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.