DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG13318

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:385 Identity:100/385 - (25%)
Similarity:159/385 - (41%) Gaps:77/385 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HLLLVSLPLLAVHATPAISPQS---LRGIIFPVETFDECQLEDVARTKGTCRR-MEDCPSALNGW 76
            |.:|....::.....|.::|.:   :..|:.|..::.:|.      ..|:|.. :...||..:|.
  Fly    55 HTILARQLIVGTLLPPQVAPGTWPPVPSIVSPGTSYCQCV------PPGSCANPLPTAPSDGSGQ 113

  Fly    77 LERR-------------ESPKTCYFVRFDHYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEF 128
            ::.|             .|..||   .:....||         ::....|...            
  Fly   114 IDIRIVNNGGYPTVPTTSSTLTC---SYGLVACC---------QAGSYQCGRR------------ 154

  Fly   129 FVSVVGGMPTRPRE-----FPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPS 188
            |....|.....|.:     :|:.|||...::     .|..|||||....||||||.....|....
  Fly   155 FPPPPGSTTAAPGQASFGAYPWQAALLTTAD-----VYLGGGALITAQHVLTAAHKVYNLGLTYF 214

  Fly   189 QVRLG-GDNLTLTE---GEDISIRRVIIHPDYSASTAYNDIALLELET----AAKPELKPTCIWT 245
            :|||| .|..:.:|   .:|:.|..|.::|.::.:...||:|:|:|.|    .:|..:...|:.|
  Fly   215 KVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCLPT 279

  Fly   246 QKEVTNTLVTAIGYGQTSFAGLSSAQLLK----VPLKSVSNEECQHHYQKDQLAQG-VLG--TQM 303
            ...|......| |:|:..|....:.|.::    |||  :.|..||...|..:|... ||.  :.:
  Fly   280 TSFVGQRCWVA-GWGKNDFGATGAYQAIERQVDVPL--IPNANCQAALQATRLGSSFVLSPTSFI 341

  Fly   304 CAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCA-SGPPSVYTRVSSFVDWIE 362
            |||...| :|.|.||.|.||:.....:.||||:.:.|.||| :|.|.||..|.:::.||:
  Fly   342 CAGGEAG-KDACTGDGGSPLVCTSNGVWYVVGLVAWGIGCAQAGVPGVYVNVGTYLPWIQ 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 11/60 (18%)
Tryp_SPc 132..364 CDD:238113 80/252 (32%)
Tryp_SPc 132..361 CDD:214473 78/249 (31%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 78/241 (32%)
Tryp_SPc 169..399 CDD:214473 76/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.