DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG14088

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:252 Identity:60/252 - (23%)
Similarity:97/252 - (38%) Gaps:55/252 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 GALIANNFVLTAAHCADLGGEPPSQVRLG-----GDNLTLTEGEDISIRRVIIHPDYSASTAYND 224
            |.||...|:||..||.|..|  ..:.|||     |..|    .||..:.....:.:::..|..|:
  Fly    60 GTLIHERFILTDVHCGDSIG--VIRARLGEYGRIGSEL----AEDHIVAAFFSNANFNPETQANN 118

  Fly   225 IALLEL--ETAAKPELKPTCIWTQKEVTNTLVTAIGYGQTSFAG-----------LSSAQLLKVP 276
            :.|::|  ....|..:.|.||.....: .|....:.|    |.|           |.|..::::|
  Fly   119 MGLMKLLRTVVYKEHIIPVCILMDSRM-QTFADELDY----FNGTTWKNSDKSPMLRSKTVIRMP 178

  Fly   277 LKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLG----YVVGI- 336
                  :.|      .:|..|    |.|||.  .:.|:|...||..|..:...:|    .:.|| 
  Fly   179 ------QAC------GKLDHG----QFCAGH--KDLDSCDEPSGAALTREIDYIGPNRTVLFGIA 225

  Fly   337 TSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQMTSF-SPEFDLRAT 392
            .|:...|::.  ..||.|.....||..:::.:.......:|:..|.. .|.|:|::|
  Fly   226 NSVEVKCSNS--RTYTDVVQLHQWISMVIYSSNTNDGMDKPHNTTHLPEPVFELKST 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 54/221 (24%)
Tryp_SPc 132..361 CDD:214473 52/218 (24%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 54/221 (24%)
Tryp_SPc 42..248 CDD:214473 52/218 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.