DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG18223

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:253 Identity:66/253 - (26%)
Similarity:112/253 - (44%) Gaps:61/253 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 CGGALIANNFVLTAAHCA----DLGGEPPSQVRLGGDNLTLTEGEDISIR---RVIIHPDYSAST 220
            |||.:|:..::||:||||    .:.......|.:.|....|...:.:|:.   :.|..||.....
  Fly    79 CGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDKFTVF 143

  Fly   221 AYNDIALLELETAAKPELKPTCIWTQKEVTNTLV----------------TAIGYGQTSFAGLSS 269
            ..|:|||:.|   ||          :..:.|.||                |.:|:|:....|..:
  Fly   144 NTNNIALMML---AK----------KLPLDNPLVGVINLPTADPEPGLNYTVLGWGRIFKGGPLA 195

  Fly   270 AQLLKVPLKSVSNEECQH--HYQKDQLAQGVLGTQMCAGDI--TGERDTCQGDSGGPLLMQDGLL 330
            :.:|.:.::.:..:.|:.  |..|:::        ||||::  |.:.:.|.||:|.||:..:   
  Fly   196 SDILHIDVELLPRDICEKKVHIFKEEM--------MCAGNLNNTMDENPCAGDTGSPLIFNE--- 249

  Fly   331 GYVVGITSLGQGCASGP-PSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQMTSFSPEF 387
             .|.|:.|...||.|.. ||:||.|...:|||.||:       |..:.|:: .:||.:
  Fly   250 -TVFGVVSYRVGCGSKTLPSIYTNVYMHMDWINGIM-------NNNEANRL-CYSPNY 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 60/228 (26%)
Tryp_SPc 132..361 CDD:214473 58/225 (26%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 60/228 (26%)
Tryp_SPc 60..280 CDD:214473 58/225 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437637
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.