DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG18180

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_648341.1 Gene:CG18180 / 39125 FlyBaseID:FBgn0036024 Length:264 Species:Drosophila melanogaster


Alignment Length:260 Identity:74/260 - (28%)
Similarity:107/260 - (41%) Gaps:69/260 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCG----GALIANNFVLTAAHCADLGGEPPSQVRL 192
            :|.|.|....:.|::..|..|::..     ..|    |.:|||:::||||||            |
  Fly    36 IVNGYPAPEGKAPYIVGLFIRTDGS-----NSGAVGAGTIIANDWILTAAHC------------L 83

  Fly   193 GGDNLTLTEGED--------ISIRR--VIIHPDYSASTAYNDIALLELETAAKPELK-------- 239
            .||.:.:..|.:        .::||  .|.|||: .|....||.|:.     .|.:.        
  Fly    84 TGDYVEIHYGSNWGWNGAYRQTVRRDNFISHPDW-PSQGGRDIGLIR-----TPHVDFNGLINKI 142

  Fly   240 --PTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLK----VPLKSVSNEECQHHYQKDQLAQGV 298
              |:.........:|...|.|:|     |:.:..|..    |.::.:||.||:..|      ..|
  Fly   143 PLPSMNEQNDRYQDTWCVACGWG-----GMDNGNLADWLQCVDVQIISNSECEQAY------GSV 196

  Fly   299 LGTQMCAGDITGERDTCQGDSGGPLLMQDG--LLGYVVGITSLGQGCASGPPSVYTRVSSFVDWI 361
            ..|.||.....| :..|.|||||||:..|.  |:|.   ||.....|..| ||.|||||.:::||
  Fly   197 ASTDMCTRHADG-KSVCGGDSGGPLVTHDNARLVGV---ITFASVSCHDG-PSGYTRVSDYLEWI 256

  Fly   362  361
              Fly   257  256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 74/260 (28%)
Tryp_SPc 132..361 CDD:214473 72/258 (28%)
CG18180NP_648341.1 Tryp_SPc 35..256 CDD:214473 72/258 (28%)
Tryp_SPc 36..259 CDD:238113 74/260 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436983
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.