DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG33465

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:236 Identity:68/236 - (28%)
Similarity:100/236 - (42%) Gaps:30/236 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 PFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLG-----GDNLTLTEGE 203
            |:||:: :::|     .:.|.|.|:...||||||.|  :..:....|..|     .|.......|
  Fly    46 PWMASI-YKNN-----QFICDGTLVHKLFVLTAASC--ISKDSQLYVLFGMYNQYRDASQFFNNE 102

  Fly   204 DISIRRVIIHPDYSASTAYNDIALLEL--ETAAKPELKPTCIWTQKEVTNTLVTAI-GYGQTSFA 265
            ...:...:.|.::..:...|||.||.|  |......::|.||.....|.:...... |:|.....
  Fly   103 QYGVAVALQHSNFRPNNGVNDIGLLRLYGEVTHYAHIRPICIILDHVVKSAPFERFEGFGWQQQG 167

  Fly   266 GLSSAQLLK-VPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGL 329
            ..:|:|:.: |.|......||..:.|...:.:|    |.|||:  .:|..|:.:||.| |..|..
  Fly   168 TEASSQVRQTVYLSQKKPFECHRNGQLLPINEG----QFCAGN--RDRSFCRSNSGSP-LTADFT 225

  Fly   330 LG-----YVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIV 365
            .|     ..||:.|.|....| |.||||.|.:|.|||...|
  Fly   226 YGVKNITVQVGLVSYGSELCS-PTSVYTDVVAFKDWIYNTV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 67/233 (29%)
Tryp_SPc 132..361 CDD:214473 65/230 (28%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 67/233 (29%)
Tryp_SPc 46..261 CDD:214473 65/230 (28%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437506
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.