DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and sphinx2

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:297 Identity:57/297 - (19%)
Similarity:108/297 - (36%) Gaps:86/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 VAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRC-- 163
            ||.:|...:...| |.||:|.         .:.||...:|....::..:         :|.:.  
  Fly     5 VALLVLSLTFSVC-EKNKLSP---------RITGGYRAKPYTIIYLVGI---------VYAKSPL 50

  Fly   164 ------GGALIANNFVLTAAHC-------ADLGGEPPSQVRLGGDNLTLTEGEDISIRRVIIHPD 215
                  .|.:|:|.::||....       |..|.:   :...|.|.|.:..      .....|.|
  Fly    51 SSLKFGAGTIISNQWILTVKEVLIFKYIEAHFGSK---RAFWGYDILRIYR------ENFYFHYD 106

  Fly   216 YSASTAYNDIALLELETAAKPELKPTCIWTQKEVTNTLVTAIGYG---------QTSFAGL-SSA 270
            .:     ..|||::            |.:.:.:...:.|....||         .|...|. :..
  Fly   107 KT-----RIIALVK------------CPYQKFDRRMSRVRVPAYGARFERYVGNMTMVCGWGTDK 154

  Fly   271 QLLKVP-------LKSVSNEECQHHYQKDQLAQGVLGTQMC-AGDITGERDTCQGDSGGPLLMQD 327
            :.:::|       ::.::|.||..::..      :...:|| :|:  |.:..|:||.||.::...
  Fly   155 RKVRLPTWMRCVEVEVMNNTECAKYHTP------LKWYEMCTSGE--GFKGVCEGDMGGAVVTMG 211

  Fly   328 GLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGI 364
            ....::..|..:...|:.|.|||:.|||..:.||:.:
  Fly   212 PNPTFIGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 49/264 (19%)
Tryp_SPc 132..361 CDD:214473 47/261 (18%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 47/262 (18%)
Tryp_SPc 26..248 CDD:304450 49/264 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437047
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.