DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG10469

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:266 Identity:72/266 - (27%)
Similarity:117/266 - (43%) Gaps:64/266 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYR--------CGGALIANNFVLTAAHCADLGGEPPS 188
            ::.|...:.::.|:...|        ..|:.        |||.:::|.:::|||||..   :|.|
  Fly    24 IMNGTAAKAKQLPYQVGL--------LCYFEGSKDEPNMCGGTILSNRWIITAAHCLQ---DPKS 77

  Fly   189 ---QVRLGGDNLTLTEGEDISIRR--VIIHPDYSASTAYNDIALLEL----------ETAAKPEL 238
               :|.:....:...:.::|.:.|  .|:|..:...|..|||||::|          :.|..|..
  Fly    78 NLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFNKYIQPAKLPSA 142

  Fly   239 KPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSA-QLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQ 302
            |       |..|.......|:|.|:....|.. |.::.|:  :||:||:..:.|.      ||.:
  Fly   143 K-------KTYTGRKAIISGWGLTTKQLPSQVLQYIRAPI--ISNKECERQWNKQ------LGGK 192

  Fly   303 ---------MCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLG-QG-CASGPPSVYTRVSS 356
                     :|.....|.  .|:||||||:::.|| ...:|||.|.| .| |....|.|.|||||
  Fly   193 SKKVVHNGFICIDSKKGL--PCRGDSGGPMVLDDG-SRTLVGIVSHGFDGECKLKLPDVSTRVSS 254

  Fly   357 FVDWIE 362
            ::.||:
  Fly   255 YLKWIK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 72/266 (27%)
Tryp_SPc 132..361 CDD:214473 70/263 (27%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 70/263 (27%)
Tryp_SPc 24..260 CDD:238113 71/264 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437059
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.