DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:251 Identity:77/251 - (30%)
Similarity:114/251 - (45%) Gaps:43/251 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            :..|......:||:...|.:.|....   :.|||::|.|.:|||||||..           |...
  Fly    40 ITNGKTATSGQFPYQVGLSFASTSGS---WWCGGSIIDNTWVLTAAHCTS-----------GASA 90

  Fly   197 LTLTEG----------EDISIRRVIIHPDYSASTAYNDIALLELETAA------KPELKPTCIWT 245
            :|:..|          :.:|....:.|..|::....|||:|::..|.|      |.|| |....|
  Fly    91 VTIYYGATVRTSAQLVQTVSADNFVQHASYNSIVLRNDISLIKTPTVAFTALINKVEL-PAIAGT 154

  Fly   246 QKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPL-KSVSNEECQHHYQKDQLAQGVLGTQMCAGDIT 309
            ....|.....|.|:|:||.:..|.|..|:..: :.||..:||:.|........|:    |.. ..
  Fly   155 YSTYTGQQAIASGWGKTSDSATSVANTLQYEVFEVVSVSQCQNTYGSLVATNNVI----CVA-TP 214

  Fly   310 GERDTCQGDSGGPL-LMQDGLLGYVVGITSL--GQGCASGPPSVYTRVSSFVDWIE 362
            .:..||.||||||| |:.|..|   :|:||.  ..||.||.|:.:|||:|::|||:
  Fly   215 NKVSTCNGDSGGPLVLVSDSKL---IGVTSFVSSAGCESGAPAGFTRVTSYLDWIK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 77/251 (31%)
Tryp_SPc 132..361 CDD:214473 75/248 (30%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 75/248 (30%)
Tryp_SPc 40..269 CDD:238113 77/251 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437031
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.