DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and Jon65Aiv

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_648012.1 Gene:Jon65Aiv / 38682 FlyBaseID:FBgn0250815 Length:271 Species:Drosophila melanogaster


Alignment Length:240 Identity:73/240 - (30%)
Similarity:117/240 - (48%) Gaps:20/240 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            :.||......:||:...|..:.:.....:  |||:||.:.:|||||||.|  |.....|.||...
  Fly    38 ITGGSNAAVGQFPYQVGLSLKLSALSSAW--CGGSLIGSTWVLTAAHCTD--GVQSVTVYLGATV 98

  Fly   197 LTLTE-GEDISIRRVIIHPDYSASTAYNDIALLEL-ETAAKPELK----PTCIWTQKEVTNTLVT 255
            .|..| ...:|...:|||..::::...|||:|::: .|::...:.    |:...:.......:..
  Fly    99 RTSAEITHTVSSSDIIIHSGWNSANLRNDISLIKIPATSSSSRISAVKLPSISNSYSTFVGDVAV 163

  Fly   256 AIGYGQTSFAGLSSAQLLK-VPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDS 319
            |.|:|:||......|..|: |.|..::|.:|...|....:....|    |.. .|..:.||.|||
  Fly   164 ASGWGRTSDTSSGVATNLQYVDLTVITNTKCAQTYGTSVVTDSTL----CVA-TTDAKSTCNGDS 223

  Fly   320 GGPLLMQDGLLGYVVGITSLG--QGCASGPPSVYTRVSSFVDWIE 362
            ||||:::..  ...:|:||.|  .||..|.|:.:|||:|::|||:
  Fly   224 GGPLVLKSS--SEQIGLTSFGASAGCEKGYPAAFTRVTSYLDWIK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 73/240 (30%)
Tryp_SPc 132..361 CDD:214473 71/237 (30%)
Jon65AivNP_648012.1 Tryp_SPc 37..265 CDD:214473 71/237 (30%)
Tryp_SPc 38..268 CDD:238113 73/240 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437035
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.