DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and yip7

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:290 Identity:88/290 - (30%)
Similarity:130/290 - (44%) Gaps:70/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 PAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRC 163
            |.:||:..|......:...:::..|:      :|.|       :||:...|.:.|:...   :.|
  Fly    20 PNIAPVHPRDRVSTPSITGRITNGKD------AVAG-------QFPYQVGLSFSSSAGS---WWC 68

  Fly   164 GGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEG----------EDISIRRVIIHPDYSA 218
            ||::|.|.:|||||||.|           |..::|:..|          :.:|..:...|..|.|
  Fly    69 GGSIIGNEWVLTAAHCTD-----------GAASVTIYYGATVRTSPEFTQVVSSSKFRQHESYLA 122

  Fly   219 STAYNDIALLELE------TAAKPELKPTCIWTQKEVTNTLVT-------AIGYGQTS-FAGLSS 269
            .|..|||:|::..      |..|..|        ..|:|:..|       |.|:|.|| .|...|
  Fly   123 LTIRNDISLIQTSSVSFSATVNKISL--------PAVSNSYSTYEGKTAVASGWGLTSDQATAVS 179

  Fly   270 AQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVV 334
            ..|..|.|..:||.:||..:....:...||    |. |.|.:..||||||||||.: ||:|   :
  Fly   180 RDLQYVDLTIISNSKCQETFGSLIVTSRVL----CV-DTTNKASTCQGDSGGPLAL-DGVL---I 235

  Fly   335 GITSLG--QGCASGPPSVYTRVSSFVDWIE 362
            |.||.|  .||.||.|:.:||::.:.|||:
  Fly   236 GATSFGSADGCESGAPAAFTRITYYRDWIK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 83/257 (32%)
Tryp_SPc 132..361 CDD:214473 81/254 (32%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 82/268 (31%)
Tryp_SPc 40..267 CDD:238113 84/270 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437023
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.