DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG15873

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:216 Identity:66/216 - (30%)
Similarity:98/216 - (45%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 CGGALIANNFVLTAAHC------ADLGGEPPSQVRLGGDNLT----LTEGEDISIRRVIIHPDYS 217
            |.|.|:::..|||||||      |.:.   |..:|:...::|    ..|.:..|:.|:::||:|.
  Fly    69 CSGVLVSSRAVLTAAHCLTDRYKASMN---PRGIRVVFGHITRLAVYDESDFRSVDRLVVHPEYE 130

  Fly   218 ASTAYNDIALLELE---TAAKPELKPTCIWTQKEVT--NTLVTAIGYGQTSFAGLSSAQL--LKV 275
            .... ||:|:|.|.   .::..::.|..:.....||  :|.:| :|:||....|..|.:|  |.|
  Fly   131 RYKK-NDLAILRLSERVQSSNHDVLPLLMRKTANVTYGDTCIT-LGWGQIYQHGPYSNELVYLDV 193

  Fly   276 PLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLG 340
            .|:..|  .||.||........|     |...: ||...|.||.|||||.:..|.|.:.|    .
  Fly   194 ILRPPS--LCQKHYDTFTADHNV-----CTEPV-GESMNCAGDMGGPLLCKGALFGLIGG----H 246

  Fly   341 QGCASGPPSVYTRVSSFVDWI 361
            .|||.|....:.....:.|||
  Fly   247 MGCAGGKAMKFLSFLYYKDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 66/216 (31%)
Tryp_SPc 132..361 CDD:214473 64/214 (30%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 60/197 (30%)
Tryp_SPc 59..250 CDD:238113 60/197 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.