DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG3700

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster


Alignment Length:350 Identity:118/350 - (33%)
Similarity:163/350 - (46%) Gaps:63/350 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GTCRRM--EDCPSALNGWLERRESPKTCYFVRFDHYVCCAPAVAPI-----------VTRSSQQA 112
            |.|:.:  .|||...  :.:.....:..|...|:..|||     ||           .||..::.
  Fly    28 GECKELTPSDCPVIF--YNQHLIGAEVKYCDEFNDIVCC-----PIPLDHQNLKPAEQTRPFEKQ 85

  Fly   113 CNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGW----RSNFDQRIYYRCGGALIANNFV 173
            |.:.|:|....:...|   :|||.....:||||||.:|.    :|..|  |.:.|||:::...||
  Fly    86 CKQYNEVRSACQSTPF---IVGGTKASGKEFPFMALIGTHRPNKSKSD--INWDCGGSVVHPKFV 145

  Fly   174 LTAAHCADLG-----------GEPPSQVRLG--GDNLTLTEG--EDISIRRVIIHPDYSASTA-- 221
            ||||||.:..           ..|...||||  ..|.|..:.  :|..:...::||.|.....  
  Fly   146 LTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQ 210

  Fly   222 --YNDIALLELETAAK--PELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSN 282
              .|||||:||:..|:  ..:...|:..........|||.|:|.|: .|:.|:.||||.|:..|:
  Fly   211 GFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSD 274

  Fly   283 EECQH--HYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGL---LGYVVGITSLGQG 342
            |.||.  .:..|      ..||.|||.::.:.|||.||||||:.:|..|   |..|:||.|.|..
  Fly   275 EVCQKRLRFSID------TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLV 333

  Fly   343 CAS-GPPSVYTRVSSFVDWIEGIVW 366
            |.| |.|||||:|..:.||||.|||
  Fly   334 CGSQGLPSVYTKVHLYTDWIESIVW 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 9/38 (24%)
Tryp_SPc 132..364 CDD:238113 97/262 (37%)
Tryp_SPc 132..361 CDD:214473 94/259 (36%)
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 97/262 (37%)
Tryp_SPc 102..353 CDD:214473 94/259 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.