DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG30283

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:115/260 - (44%) Gaps:41/260 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 IDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQ 189
            |.:|  .::||........|:||.:.....|      .|||.||.|.||||:|||. ..||  .:
  Fly    38 ISQF--KILGGHNAPVASAPWMAMVMGEGGF------HCGGTLITNRFVLTSAHCI-ANGE--LK 91

  Fly   190 VRLGGDNLTL---TEGEDISIRRVIIHPDYSASTAYNDIALLELETAA--KPELKPTCIWTQKEV 249
            ||||    .|   .|.:..::..:.:|.||...  .:|:|||.|....  ...:.|.|:.....|
  Fly    92 VRLG----VLEREAEAQKFAVDAMFVHTDYYFD--QHDLALLRLAKRVHYSDNISPICLLLDPLV 150

  Fly   250 TN-----TLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDIT 309
            .|     ......|:|:|. :..||..|.|..|.::...||...|...|:.:    ..:||.  :
  Fly   151 KNIDEHIVKFRTYGWGKTE-SRSSSRMLQKTSLFNLHRSECAKQYPHQQINR----NHICAE--S 208

  Fly   310 GERDTCQGDSGGPL---LMQDGL-LGYVVGITSLGQG-CASGPPSVYTRVSSFVDWIEGIVWPAQ 369
            ...:||.|||||||   :..|.: :.:..|:||.|.. |:..  :|:|.|.:.:|||...|..|:
  Fly   209 ANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKA--TVFTNVMTHLDWIVNTVRRAE 271

  Fly   370  369
              Fly   272  271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 74/246 (30%)
Tryp_SPc 132..361 CDD:214473 72/243 (30%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 72/244 (30%)
Tryp_SPc 43..266 CDD:238113 74/246 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.