DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG12133

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_610540.2 Gene:CG12133 / 36036 FlyBaseID:FBgn0033469 Length:340 Species:Drosophila melanogaster


Alignment Length:324 Identity:102/324 - (31%)
Similarity:143/324 - (44%) Gaps:70/324 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KTCYFVRFDH------YVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPRE 142
            |.|....|.|      :.|| |.||......| :.|.:....|          .:||||..:..:
  Fly    20 KLCNINPFAHELVHMVFTCC-PMVAGDKLPDS-RVCGQSPPSS----------YIVGGMEAQSNQ 72

  Fly   143 FPFMAALGWRS-NFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLG-------GDNLTL 199
            ||:...||:.: ...||....|.|:|||:.:|||||||.::.....::||||       .|...|
  Fly    73 FPWTVLLGYEAYTAKQRPSPMCAGSLIASRYVLTAAHCLNVNDFYVARVRLGEHDTENDPDYTWL 137

  Fly   200 TEGE--------DISIRRVIIHPDYSASTA--YNDIALLELETAAK--PELKPTCIWTQKEVT-- 250
            ..|.        ||.:...:.|..|.....  |||||||.|::..|  .:::|.|||...|::  
  Fly   138 PNGAKIWAPAHVDIDVDLRVPHEQYYTRNGRHYNDIALLRLKSRVKYTLQIRPICIWPGIELSTS 202

  Fly   251 ---NTLVTAIGYGQTSFAGL--SSAQLLKVPLKSVSNEECQHHY-----QKDQLAQGVLGTQMCA 305
               |......|:|.   :||  .|..|.:..:..:|.:||.:.|     .||        .|:||
  Fly   203 SFKNFPFQIAGWGD---SGLQQKSTVLRQGTISGMSPDECLNRYPTLLVDKD--------IQICA 256

  Fly   306 GDITGERDTCQGDSGGPLLMQDG----LLGYVVGITSLGQGCAS---GPPSVYTRVSSFVDWIE 362
            ....| .||..||||.||:...|    ...|:.||||.|.|.:|   | |:|||:.||:.:||:
  Fly   257 MGWDG-TDTGLGDSGSPLMASVGRGADQFYYLAGITSYGGGPSSYGYG-PAVYTKTSSYYEWIK 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 5/19 (26%)
Tryp_SPc 132..364 CDD:238113 90/270 (33%)
Tryp_SPc 132..361 CDD:214473 88/267 (33%)
CG12133NP_610540.2 Tryp_SPc 62..320 CDD:238113 90/270 (33%)
Tryp_SPc 62..317 CDD:214473 88/267 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437418
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.