DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and try-9

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:280 Identity:56/280 - (20%)
Similarity:96/280 - (34%) Gaps:79/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SNFDQRIYYRCG-GALIANNFVLTAAHCADLGGEPPSQVRLGG----------------DNLTLT 200
            :.|.:..:.:.| |.|::...::||||...:..:|......|.                .|:|..
 Worm    17 NKFSENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYKNFVAFVNVTCA 81

  Fly   201 EGE------------DISIRRVIIHPDYSAS-----TAYNDIALLELETAAK--PELKPTCIWTQ 246
            ..|            .::|:.:.|...|...     .::||||:.|||...:  .::.|.|:.:.
 Worm    82 VPEMCKGLHRKDMFKPLAIKSLYIRKGYVGDGCIDRESFNDIAVFELEEPIEFSKDIFPACLPSA 146

  Fly   247 KEVTNTLVTA---IGYGQTSFAGLSSAQLLKVPLKSVSN--EECQHHYQKDQLAQGVLGTQMCAG 306
            .::.....|.   .|||:..    |.:.|....|||:.:  .||...:.        .|...|..
 Worm   147 PKIPRIRETGYKLFGYGRDP----SDSVLESGKLKSLYSFVAECSDDFP--------YGGVYCTS 199

  Fly   307 DITGERDTCQGDSGGPLLMQDGL--LGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQ 369
            .: ....:|.||||..::.....  :..:||:.|.|..|    |.:|.                 
 Worm   200 AV-NRGLSCDGDSGSGVVRTSDTRNVQVLVGVLSAGMPC----PELYD----------------- 242

  Fly   370 QVTNAPQPNQMTSFSPEFDL 389
              |:..|..|....:.|.||
 Worm   243 --THNRQRQQRRQLTQETDL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 50/253 (20%)
Tryp_SPc 132..361 CDD:214473 50/250 (20%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 45/219 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.