DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and scaf

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:408 Identity:97/408 - (23%)
Similarity:140/408 - (34%) Gaps:143/408 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PTRVYLHLLLVSLPLLAVHATPAISP----------------QSLRGIIFPV-------ETFDEC 51
            ||..|       ||..|.:..|...|                ..|...|||.       :.|.:|
  Fly   287 PTNEY-------LPPAAANEIPRFEPDRAPQPSNQKPIYRGEDQLSPQIFPTPQPANVPKHFAKC 344

  Fly    52 QLEDVARTKGTCRR---------------------MEDCPSALNGWLERRESPKTCYFVRFDHYV 95
            ....|..::..|..                     :.||....||      ||..|  .|..:||
  Fly   345 ASALVCTSENFCNAIGVLSETPVELSPMEAAFRVPLTDCLQTENG------SPGKC--CRDPNYV 401

  Fly    96 ---------CCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGW 151
                     .||       ||      |:..|.:.||::|..|.           |.|:.|.: .
  Fly   402 DPWPVNLAGVCA-------TR------NKRTKPTGVKDLDANFA-----------EIPWQAMI-L 441

  Fly   152 RSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVR-------LGGDN----LTLTEGEDI 205
            |.:....|   ||||:|.:.|||::|.|  :.|.|.:.:|       ||..|    ..||     
  Fly   442 RESSKTLI---CGGAIIGDQFVLSSASC--VNGLPVTDIRVKAGEWELGSTNEPLPFQLT----- 496

  Fly   206 SIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLS 268
            .::.|.:||||..||..:|:|::.||...:  ..::|.||..:....:......|:|:       
  Fly   497 GVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGK------- 554

  Fly   269 SAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITG-----ERDTCQGDSGGPLLMQDG 328
              |.|.:      :||....:..|.|.|   ....|:.|.:.     :.|:||.|.|..|....|
  Fly   555 --QALSI------HEEGALMHVTDTLPQ---ARSECSADSSSVCSATKFDSCQFDVGSALACGSG 608

  Fly   329 ----LLGYVVGITSLGQG 342
                |.|...|..|.|:|
  Fly   609 SSVRLKGIFAGENSCGEG 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 13/76 (17%)
Tryp_SPc 132..364 CDD:238113 61/233 (26%)
Tryp_SPc 132..361 CDD:214473 61/233 (26%)
scafNP_610180.1 FtsK <198..>334 CDD:332908 12/53 (23%)
Tryp_SPc 428..616 CDD:238113 58/227 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435573
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.