DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG31220

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:304 Identity:90/304 - (29%)
Similarity:132/304 - (43%) Gaps:49/304 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRS----N 154
            |:||.   .|..|..|...|.:....::          |:||......|:|::|.|.:|:    |
  Fly    79 YICCP---KPANTLPSYPDCGKPQTTNR----------VIGGTEPNLNEYPWLAMLLYRNRSAFN 130

  Fly   155 FDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLT-----LTEGE---------DI 205
            .|:.:...|||:||...:|||||||.........:||||....:     ::.|.         ||
  Fly   131 PDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRGARIVCAPTHLDI 195

  Fly   206 SIRRVIIHPDYSAS--TAYNDIALLELETAAKPELK--PTCIWT-QKEVTNTLVTAIGYGQTSFA 265
            .:..:..|.||..:  |..|||||:.|:...:..:.  |.|:.. .:.:....:...|:|:|...
  Fly   196 DVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYVAGWGKTGMF 260

  Fly   266 GLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGT--QMCAGDITGERDTCQGDSGGPLLMQDG 328
            ...|..|....:|....|||...|     |....|.  |:|||.: ..|.||.||||.||:...|
  Fly   261 DTGSKVLKHAAVKVRKPEECSEKY-----AHRHFGPRFQICAGGL-DNRGTCDGDSGSPLMGTSG 319

  Fly   329 ----LLGYVVGITSLGQGCAS-GPPSVYTRVSSFVDWIEGIVWP 367
                .:.::.||||.|..|.: |.|||:||.:.|..||...:.|
  Fly   320 RSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIRAHLRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 2/3 (67%)
Tryp_SPc 132..364 CDD:238113 82/261 (31%)
Tryp_SPc 132..361 CDD:214473 80/258 (31%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 80/269 (30%)
Tryp_SPc 104..360 CDD:238113 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437398
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.