DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG31269

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:244 Identity:75/244 - (30%)
Similarity:109/244 - (44%) Gaps:32/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            ::||........|:..:|...|.     .:.||||:|...||||||||.: ....|..|.:.|.|
  Fly    38 IIGGQAAEDGFAPYQISLQGISG-----AHSCGGAIINETFVLTAAHCVE-NAFIPWLVVVTGTN 96

  Fly   197 LTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPTCIWTQKEVTNTL-------- 253
            .....|....::.:.||.:|.....:||||||||       ::|.. |.::.....|        
  Fly    97 KYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLEL-------VEPIA-WDERTQPIPLPLVPMQPG 153

  Fly   254 --VTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQ 316
              |...|:|.|...|.|...|..:.|:.|.:.||:.....|:...  :| .:|.....|| ..|.
  Fly   154 DEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCD--VG-HICTFSRLGE-GACH 214

  Fly   317 GDSGGPLLMQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIV 365
            |||||||:..    ||:||:.:.|..||:|.|.|:..|..:.|||..::
  Fly   215 GDSGGPLVSN----GYLVGLVNWGWPCATGVPDVHASVYFYRDWIRNVM 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 75/241 (31%)
Tryp_SPc 132..361 CDD:214473 73/238 (31%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/238 (31%)
Tryp_SPc 38..258 CDD:238113 75/241 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.