DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and GZMA

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_006135.2 Gene:GZMA / 3001 HGNCID:4708 Length:262 Species:Homo sapiens


Alignment Length:243 Identity:78/243 - (32%)
Similarity:119/243 - (48%) Gaps:30/243 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            ::||....|...|:|..|    :.|::..  |.|||||.::||||||| :|...  |||.||..:
Human    29 IIGGNEVTPHSRPYMVLL----SLDRKTI--CAGALIAKDWVLTAAHC-NLNKR--SQVILGAHS 84

  Fly   197 LTLTE--GEDISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPTCIWTQKE----VTNTLVT 255
            :|..|  .:.:.:::...:|.|..:|...|:.||:|...||.....|.:...|:    ...|:..
Human    85 ITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQ 149

  Fly   256 AIGYGQTSFAGLSSAQLLKVPLKSVSNEEC--QHHYQKDQLAQGVLGTQM-CAGDITGERDTCQG 317
            ..|:|:|..:...|..|.:|.:..:..:.|  ::||..:.    |:|..| |||.:.|.||:|.|
Human   150 VAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNP----VIGMNMVCAGSLRGGRDSCNG 210

  Fly   318 DSGGPLLMQDGLLGYVVGITSLGQGCASGP---PSVYTRVS-SFVDWI 361
            |||.|||.:    |...|:||.|.....|.   |.||..:| ..::||
Human   211 DSGSPLLCE----GVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 78/243 (32%)
Tryp_SPc 132..361 CDD:214473 76/241 (32%)
GZMANP_006135.2 Tryp_SPc 29..254 CDD:238113 76/241 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.