DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG33462

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_995844.2 Gene:CG33462 / 2768841 FlyBaseID:FBgn0053462 Length:300 Species:Drosophila melanogaster


Alignment Length:258 Identity:69/258 - (26%)
Similarity:108/258 - (41%) Gaps:41/258 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 GMPTRPREFPFMAALG---WRSNFDQRIYYRCGGALIANNFVLTAAHCA--DL-----GGEPPSQ 189
            |:|....|....|.|.   |.:..:....:.|.|.||.:.||||||||.  ||     .||..::
  Fly    30 GIPHNISERSVNAKLAQNPWMAYLETPKGFHCSGTLINHLFVLTAAHCVPDDLLITVRLGEYNTK 94

  Fly   190 VRLGGDNLTLTE-----GEDISIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQK 247
            .::..||....|     ..|:..|    |..|:|:...|||.:|.|....:  ..::|.||:...
  Fly    95 TKVDCDNHLCQEPFQEYNVDMGFR----HRYYNANDQTNDIGMLRLGRRVEYLNHIRPICIFASN 155

  Fly   248 EVTN-----TLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGD 307
            ....     |..|...:.:|: |..:|..|..:.:.....|.|...|..:...:     |:|||:
  Fly   156 RFQEPIDQLTWFTTTVWRETA-ANATSKVLRTMNIDRQPKETCSEIYGWNMTFE-----QICAGN 214

  Fly   308 ITGERDTCQGDSGGPLLMQ---DGLLGYV-VGITSLGQG-CASGPPSVYTRVSSFVDWIEGIV 365
            ...:  .|..|||.|.:.:   :|...|| :||.|..:| |.:.  .:...:.|:.|||:.:|
  Fly   215 TLSQ--LCSTDSGAPQIRKMWHNGSDRYVQLGIASRVKGQCQNS--GILMDLLSYADWIKRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 68/255 (27%)
Tryp_SPc 132..361 CDD:214473 66/252 (26%)
CG33462NP_995844.2 Tryp_SPc 48..272 CDD:238113 63/237 (27%)
Tryp_SPc 48..269 CDD:214473 61/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437490
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.