DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG30187

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:270 Identity:81/270 - (30%)
Similarity:119/270 - (44%) Gaps:66/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 WRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDISIRR----VI 211
            |.:....|.::.|||.||...||||||||  :..:....|.||..|.:     |.:.|:    .:
  Fly    49 WMAAVHNRTHFICGGTLIHKRFVLTAAHC--IVDQDVQSVSLGAYNKS-----DPADRKDVITAV 106

  Fly   212 IHPDYSASTAY-NDIALLEL--ETAAKPELKPTCIWTQKEVTNTL-----VTAIGYGQTSFAGLS 268
            :|..:....:| |||.||:|  :......::|.||...|.:.|.:     ..|.|:|  :..|..
  Fly   107 VHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTFKAFGWG--TLRGNK 169

  Fly   269 SAQLLK-VPLKSVSNEECQHH---YQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLL----- 324
            ::.:|: :.|..:..|||...   |..::        |:|||..:|  |||.|||||||.     
  Fly   170 TSDILQTIILNHLDREECYMELSVYPSEK--------QICAGVPSG--DTCGGDSGGPLTNDVFI 224

  Fly   325 -------MQDGLLGYVVGITSL-GQGCASGPPSVYTRVSSFVDWIEGIVWPAQQVTNAPQ----- 376
                   :|.|::.  ||.||. |||       |||.:.||.|||:..: ....:.:.||     
  Fly   225 QGIGNREVQFGIIS--VGKTSCDGQG-------VYTDLMSFADWIKMTI-ERLSIEDEPQSAPFY 279

  Fly   377 ---PNQMTSF 383
               |.|...|
  Fly   280 KIIPQQQDVF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 76/241 (32%)
Tryp_SPc 132..361 CDD:214473 74/238 (31%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 74/238 (31%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.