DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG30098

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:248 Identity:79/248 - (31%)
Similarity:116/248 - (46%) Gaps:39/248 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRL 192
            |.:.|:||.  ..|..|:||.| .|.|     .:.|||:|||..||||||||..:...  ..|||
  Fly    33 FRIRVIGGQ--NARRTPWMAYL-IRDN-----RFACGGSLIAYRFVLTAAHCTKINDN--LFVRL 87

  Fly   193 GG-DNLTLTEGEDISIRRVII--HPDYSASTAYNDIALLELETAAKPE--LKPTCIWTQ---KEV 249
            |. |:...|:|:..|.|.|.|  |.:| .....:|||:|:|:.....:  ::|.||...   :.:
  Fly    88 GEYDSSRTTDGQTRSYRVVSIYRHKNY-IDFRNHDIAVLKLDRQVVYDAYIRPICILLNSGLQSL 151

  Fly   250 TNTL--VTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGER 312
            .|::  .|..|:||.:........|.::.|:.|.||.|           ||....:|..:..  :
  Fly   152 ANSIQNFTLTGWGQMAHYYKMPTTLQEMSLRRVRNEYC-----------GVPSLSICCWNPV--Q 203

  Fly   313 DTCQGDSGGPL--LMQDGLLGYVV--GITSLGQGCASGPPSVYTRVSSFVDWI 361
            ..|.|||||||  |::.|.....|  |:|:...|...|..| |..:.|::.|:
  Fly   204 YACFGDSGGPLGSLVKYGHKTIYVQFGVTNSVTGNCDGYSS-YLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 78/244 (32%)
Tryp_SPc 132..361 CDD:214473 77/242 (32%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 77/242 (32%)
Tryp_SPc 37..258 CDD:238113 78/244 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437526
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.