DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG30088

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_725488.3 Gene:CG30088 / 246447 FlyBaseID:FBgn0050088 Length:281 Species:Drosophila melanogaster


Alignment Length:304 Identity:91/304 - (29%)
Similarity:128/304 - (42%) Gaps:70/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 YVC-CAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQ 157
            |:| |...|.     ..|.|.|.|.....|.........:|.|.....:..||||.|.:.|..  
  Fly    11 YICMCVCLVL-----QEQVAANFLIPSCGVSYESNVATRIVRGKEAMLKSAPFMAYLYYSSEI-- 68

  Fly   158 RIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLT---EGEDISIRRVIIHP----- 214
                .|||.:|::.::||||||.    .|..:||||..::|..   :|...|       |     
  Fly    69 ----HCGGTIISSRYILTAAHCM----RPYLKVRLGEHDITRNPDCQGGSCS-------PPAEEF 118

  Fly   215 DYSASTAY--------NDIALLELETAAK--PELKPTCIWTQKEVTNTLVT-------AIGYGQT 262
            |...:|.|        ||||||:|....:  ..::|.|:     :.|....       |.|:|||
  Fly   119 DIVLATKYKRFDRFLANDIALLKLSRNIRFNVHIQPICL-----ILNPAAAPNVHEFQAFGWGQT 178

  Fly   263 SFAGLSSAQLLKVP-LKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQ 326
            ...  .||.:|:.. |....|..|     :..|:..:...|:|.| ..|. |||.|||||||:.:
  Fly   179 ETN--HSANVLQTTVLTRYDNRHC-----RSVLSMPITINQLCVG-FQGS-DTCSGDSGGPLVTK 234

  Fly   327 ---DGLLGYV-VGITSLGQG-CASGPPSVYTRVSSFVDWIEGIV 365
               ||:..|: :||.|.|.. |.|  |.|||.|.:::.||..::
  Fly   235 VNYDGVWRYLQLGIVSFGDDKCQS--PGVYTYVPNYIRWIRYVM 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 2/4 (50%)
Tryp_SPc 132..364 CDD:238113 82/262 (31%)
Tryp_SPc 132..361 CDD:214473 80/259 (31%)
CG30088NP_725488.3 Tryp_SPc 44..272 CDD:214473 80/260 (31%)
Tryp_SPc 45..273 CDD:238113 81/260 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437478
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.