DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG30087

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_725489.2 Gene:CG30087 / 246446 FlyBaseID:FBgn0050087 Length:277 Species:Drosophila melanogaster


Alignment Length:272 Identity:85/272 - (31%)
Similarity:124/272 - (45%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCA 180
            ||.:..|....:..:.||.|.....|..|||..:...|      ...|||:::.:.::||||||.
  Fly    26 LNPLCGVTYESQTAMRVVNGKEAVIRSAPFMVYVTNNS------LTHCGGSILNSRYILTAAHCV 84

  Fly   181 DLGGEPPSQVRLGGDNLTL----------TEGEDISIRRVIIHPDYSASTAYNDIALLELETAA- 234
                .|..::|||..|:..          ...|:..|.:.|.|..|:|:...||||||:|..:. 
  Fly    85 ----FPNLRLRLGEHNIRTDPDCQGSNCSPRSEEYGIMKAITHRFYNAANHVNDIALLKLNRSIN 145

  Fly   235 -KPELKPTCIWTQKEVTNTLVT--AIGYGQTSFAG----LSSAQLLKVPLKSVSNEECQ---HHY 289
             ...::|.||........::.|  ..|:|:|...|    |.:|:     |::.....|.   |.|
  Fly   146 FNVHIQPICILLNPASAPSVATYQTFGWGETKKNGFPHLLQTAE-----LRAYDAAYCSRSFHAY 205

  Fly   290 QKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQ---DGLLGYV-VGITSLG-QGCASGPPS 349
            ..        |.|:|||.  .|||||.|||||||:.:   ||:..|: :||.|.| ..|.|  |.
  Fly   206 MN--------GNQICAGH--EERDTCAGDSGGPLVTRVDFDGVKRYLQLGIVSYGPTDCQS--PG 258

  Fly   350 VYTRVSSFVDWI 361
            |||.|.::::||
  Fly   259 VYTYVPNYINWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 82/256 (32%)
Tryp_SPc 132..361 CDD:214473 80/254 (31%)
CG30087NP_725489.2 Tryp_SPc 41..270 CDD:214473 80/255 (31%)
Tryp_SPc 42..272 CDD:238113 82/256 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437482
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.