DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG30083

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_725492.3 Gene:CG30083 / 246444 FlyBaseID:FBgn0050083 Length:279 Species:Drosophila melanogaster


Alignment Length:322 Identity:93/322 - (28%)
Similarity:133/322 - (41%) Gaps:83/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 PSALNGWLERRESPKTCYFVRFDHYVCCAPAVAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVG 134
            |.|::.:||..               |..|.::|.:.. .|.|.|..|                 
  Fly    14 PGAMSQFLEPN---------------CGYPDISPKIMH-GQNAENGTN----------------- 45

  Fly   135 GMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTL 199
                     |:||.: ::.|..:.....|||.||...|||:||||  :..:....||||..    
  Fly    46 ---------PWMAYI-FKYNDKEVAELVCGGTLIHKQFVLSAAHC--IKRDQILAVRLGEH---- 94

  Fly   200 TEGEDISIRRVIIHPDYSASTAYNDIALLELETAAK--PELKPTCIWTQKEVTNTLVT--AIGYG 260
            :.....::.:...:..::..:..|||.:|.::...|  ..::|.||.|.......:.|  |.|:|
  Fly    95 SSSRYFAVTKAFRNKYFTTGSYSNDIGILRIQPIVKFNAVIRPICIITDPTKVPNVKTFKAAGWG 159

  Fly   261 QTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLL- 324
            :|.....|.. |..|.|..::..||.     :.|...|..:|:|||...|  |||.|||||||: 
  Fly   160 KTENETFSKV-LKTVELNELNASECY-----NMLWVNVTESQICAGHPDG--DTCAGDSGGPLIH 216

  Fly   325 --MQDGLLGYV-VGITSLGQG-CASGPPSVYTRVSSFVDWIEGI---------------VWP 367
              ..||.|.|| :||.|.|.. |.|  |.||||:|||:|||..:               |||
  Fly   217 PVYMDGSLRYVQLGIISFGSSLCNS--PGVYTRLSSFIDWILMVVDNYTVRSPPKIQYRVWP 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829 5/27 (19%)
Tryp_SPc 132..364 CDD:238113 79/240 (33%)
Tryp_SPc 132..361 CDD:214473 77/237 (32%)
CG30083NP_725492.3 Tryp_SPc 33..255 CDD:214473 81/265 (31%)
Tryp_SPc 34..255 CDD:238113 81/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437446
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.