DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and try-4

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:274 Identity:60/274 - (21%)
Similarity:113/274 - (41%) Gaps:66/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 REFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAH------------CADLGGEPPS----- 188
            :.||      |..:|......|.||::|:...::||||            |.:...:.|:     
 Worm    56 KNFP------WAVSFTVDGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYR 114

  Fly   189 ---------QVRLGGDNLTLTEG-------------EDI---SIRRVIIHPDYSASTAY--NDIA 226
                     :|..||   |...|             .|:   .:|.|::..::::|...  :|.|
 Worm   115 SIKFLRDTRKVAYGG---TCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWA 176

  Fly   227 LLELETAA--KPELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHY 289
            ::|:|...  ...::|.|:..........:...|:|::.....|...:.::|::  .:.:|:..:
 Worm   177 IVEVEKRIHFSENVRPICLPRPNMYYTKSLAVPGWGRSYIFNESGPLIHEIPMR--IDRDCKRPW 239

  Fly   290 QKDQLAQG----VLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLG--YVVGITSLG-QGCASGP 347
             .|:|...    :..|.|...:.:..| ||.|||||.|..:|...|  :::.|||.| :||.|..
 Worm   240 -SDRLPADADDFICATSMNVSNYSAPR-TCHGDSGGGLEYRDDNYGRAFLIAITSFGTRGCPSNM 302

  Fly   348 PSVYTRVSSFVDWI 361
            .:.:|||..:::.|
 Worm   303 LARFTRVDMYLNLI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 60/274 (22%)
Tryp_SPc 132..361 CDD:214473 59/272 (22%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 60/274 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.