DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and Gzmk

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_032222.1 Gene:Gzmk / 14945 MGIID:1298232 Length:263 Species:Mus musculus


Alignment Length:258 Identity:78/258 - (30%)
Similarity:127/258 - (49%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 FFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADL--GGEPPSQV 190
            |...::||...:|...||||::.:||.      :.|||.||...:|||||||...  .|..|:.|
Mouse    22 FHTEIIGGREVQPHSRPFMASIQYRSK------HICGGVLIHPQWVLTAAHCYSWFPRGHSPTVV 80

  Fly   191 RLGGDNLTLTE--GEDISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPTCIWTQ------- 246
             ||..:|:..|  .:...|::.|......:.:|.:||.|::|.|||  ||........       
Mouse    81 -LGAHSLSKNEPMKQTFEIKKFIPFSRLQSGSASHDIMLIKLRTAA--ELNKNVQLLHLGSKNYL 142

  Fly   247 KEVTNTLVTAIGYGQTSFAGLSSAQLLK-VPLKSVSNEEC--QHHYQKDQLAQGVLGTQMCAGDI 308
            ::.|...||  |:|.|....|:::..|: |.:..:|.:.|  |.:|....:   :....:||||.
Mouse   143 RDGTKCQVT--GWGTTKPDLLTASDTLREVTVTIISRKRCNSQSYYNHKPV---ITKDMICAGDA 202

  Fly   309 TGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCA-SGPPSVYTRVS-SFVDWIEGIVWPAQ 369
            .|::|:|:|||||||:.:    |....:.|.|..|. :..|.:||.:: .:..||:..:.|::
Mouse   203 RGQKDSCKGDSGGPLICK----GIFHALVSQGYKCGIAKKPGIYTLLTKKYQTWIKSKLAPSR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 76/247 (31%)
Tryp_SPc 132..361 CDD:214473 74/244 (30%)
GzmkNP_032222.1 Tryp_SPc 25..253 CDD:214473 74/245 (30%)
Tryp_SPc 26..256 CDD:238113 76/247 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.