DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG43742

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:252 Identity:86/252 - (34%)
Similarity:120/252 - (47%) Gaps:71/252 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 FMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCA-DLGGEPPSQVRLGGDNLTLTEGED---- 204
            |||||...|.|      .|||:||...:|||||||. ||            |.:|:..||:    
  Fly    46 FMAALYNNSEF------FCGGSLIHKQYVLTAAHCVRDL------------DEVTVHLGENNRSC 92

  Fly   205 -ISI--------RRVIIHPDYSASTAYNDIALLELETAA--KPELKPTCIWTQKEVTN---TLVT 255
             |.:        .:||:||::..:...||||||.||...  :..::|.||...::||:   ...|
  Fly    93 PIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICIILDEDVTSNNQNNFT 157

  Fly   256 AIGYGQTSFAGLSSA----QLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQ 316
            |.|:|:|....:|..    .|:::| ||:    |   ||.       :.| :|||..:|  |||:
  Fly   158 AYGWGKTEHGNISDVLSFIDLVRLP-KSM----C---YQN-------INT-ICAGSTSG--DTCE 204

  Fly   317 GDSGGPLL--------MQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIV 365
            .||||||:        .:|.|.    ||||.|....||...|||.|:::..||..:|
  Fly   205 SDSGGPLIGNFVHRGKSRDILF----GITSYGDAECSGLFGVYTDVNAYKSWIASVV 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 85/249 (34%)
Tryp_SPc 132..361 CDD:214473 83/246 (34%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 83/246 (34%)
Tryp_SPc 35..256 CDD:238113 85/249 (34%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437502
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.