DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and F9

DIOPT Version :10

Sequence 1:NP_572492.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:266 Identity:84/266 - (31%)
Similarity:126/266 - (47%) Gaps:40/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCA 180
            ||.|::..|....|..||||...:|.:.|      |:...:..|...||||:|...:::|||||.
Mouse   221 LNNVTESSESLNDFTRVVGGENAKPGQIP------WQVILNGEIEAFCGGAIINEKWIVTAAHCL 279

  Fly   181 DLGGEPPSQVRLGGDNLTLTEGEDISIRRVII----HPDYSAS-TAY-NDIALLELETAAKP--- 236
                :|..::.:......:.:.||...||.:|    |..|:|: ..| :|||||||:   ||   
Mouse   280 ----KPGDKIEVVAGEYNIDKKEDTEQRRNVIRTIPHHQYNATINKYSHDIALLELD---KPLIL 337

  Fly   237 --ELKPTCIWTQKEVTNTLVT-----AIGYGQTSFAG--LSSAQLLKVPLKSVSNEECQHHYQKD 292
              .:.|.|: ..:|.||..:.     ..|:|:....|  .|..|.|:|||  |....|..     
Mouse   338 NSYVTPICV-ANREYTNIFLKFGSGYVSGWGKVFNKGRQASILQYLRVPL--VDRATCLR----- 394

  Fly   293 QLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQGCA-SGPPSVYTRVSS 356
            .....:.....|||...|.:|:|:||||||.:.:.....::.||.|.|:.|| .|...:||:||.
Mouse   395 STTFTIYNNMFCAGYREGGKDSCEGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSR 459

  Fly   357 FVDWIE 362
            :|:||:
Mouse   460 YVNWIK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_572492.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 79/250 (32%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:464251
Tryp_SPc 237..467 CDD:238113 79/250 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.