DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG43336

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:271 Identity:83/271 - (30%)
Similarity:116/271 - (42%) Gaps:58/271 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 FVSVVGGM----PTRPR----------EFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHC 179
            |:.:..|:    |:.||          ..|:||.|   .:.|.|  :.|||:||.|..|||||||
  Fly    21 FLDMACGIRAHSPSVPRVKNGTVASLTSSPWMAFL---HSTDGR--FICGGSLITNRLVLTAAHC 80

  Fly   180 --------ADLGGEPPSQVRLGGDNLTLTEGEDISIRRVIIHPDYSASTAYNDIALLEL--ETAA 234
                    |.||.....:..:..|:. .|...:..:.|...|..|:..|...|||:|.|  :...
  Fly    81 FLDRTELVARLGEYDREEYEMCHDSY-CTYRIEAMVERGFRHRHYNPMTMAYDIAILRLYRKVQY 144

  Fly   235 KPELKPTCI-----WTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQL 294
            ...::|.||     |.:...:...:|..|:|:|...| .||:|..|.|.....|.|:.:     .
  Fly   145 TDNIRPICIVIDPRWRKYIDSLDPLTGTGWGKTESEG-DSAKLRTVDLARKHPEVCRRY-----A 203

  Fly   295 AQGVLGTQMCAGDITGER-DTCQGDSGGPLLMQDGLLGY-------VVGITSL-GQGCASGPPSV 350
            ...:...|.|||:   || :.|.||||||:   ..|:.|       .|||.|. ...|..  .||
  Fly   204 TLSLTANQFCAGN---ERSNLCNGDSGGPV---GALIPYGKSKRFVQVGIASFTNTQCVM--VSV 260

  Fly   351 YTRVSSFVDWI 361
            :|.|.|:||||
  Fly   261 FTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 82/268 (31%)
Tryp_SPc 132..361 CDD:214473 80/266 (30%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 77/253 (30%)
Tryp_SPc 40..271 CDD:238113 76/250 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.