DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG43110

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:245 Identity:78/245 - (31%)
Similarity:112/245 - (45%) Gaps:33/245 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQ---VRLG 193
            ::.|.....:...:||.:     |: ..:..|||.:|..:||||.|||..      :|   ||||
  Fly    36 IISGSNASQQSAQYMAGI-----FN-TTHLLCGGTIIHEDFVLTVAHCKS------TQTLFVRLG 88

  Fly   194 GDNLTLTEGEDISIRRVIIHPDYSASTAYNDIALLELETAA--KPELKPTCIWTQKEVTNTL--V 254
            ..|:. ...:.|.:...|.||.||.||..|||||::||.:.  ...::|.||.....:...:  .
  Fly    89 AYNIN-HPTDQIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIRYY 152

  Fly   255 TAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDS 319
            .|.|:|:|..|  ..:.:|:....:.:|....|.|    |.......|:||  .|.:.|||.|||
  Fly   153 NAFGWGRTRNA--EQSDILQRIFVNRTNPMICHLY----LGMSPDPKQICA--TTDQGDTCAGDS 209

  Fly   320 GGPLLMQDGLLG----YVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIV 365
            ||||:.:....|    ...||||.|....:| ..:||.||.:..||..||
  Fly   210 GGPLISKITYQGKNFDTQFGITSYGTRECNG-VGLYTDVSQYSGWIANIV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 76/242 (31%)
Tryp_SPc 132..361 CDD:214473 74/239 (31%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 74/239 (31%)
Tryp_SPc 36..257 CDD:238113 76/242 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.