DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CTRC

DIOPT Version :10

Sequence 1:NP_572492.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_011538852.1 Gene:CTRC / 11330 HGNCID:2523 Length:280 Species:Homo sapiens


Alignment Length:113 Identity:42/113 - (37%)
Similarity:62/113 - (54%) Gaps:9/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            ||||...||..:|:..:|.:..|...|  :.|||.|||:|||||||||  :......:|.:|.:|
Human    30 VVGGEDARPHSWPWQISLQYLKNDTWR--HTCGGTLIASNFVLTAAHC--ISNTRTYRVAVGKNN 90

  Fly   197 LTLTEGED---ISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPT 241
            |.:.:.|.   :.:..:.:|..::|....|||||::|  |...||..|
Human    91 LEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKL--AEHVELSDT 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_572492.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 42/113 (37%)
CTRCXP_011538852.1 Tryp_SPc 30..>173 CDD:238113 42/113 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.