DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and LOC101886682

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_005170582.2 Gene:LOC101886682 / 101886682 -ID:- Length:252 Species:Danio rerio


Alignment Length:276 Identity:83/276 - (30%)
Similarity:123/276 - (44%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 VSKVKEIDEFFVSVVG---GMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCA 180
            ||.|.::.  |.:.||   |...:|...|:|.:|...|   |.|   |||:||:..||||||||.
Zfish    13 VSLVPDLT--FTARVGIEDGTEAKPHSRPYMVSLQINS---QHI---CGGSLISKEFVLTAAHCW 69

  Fly   181 DLGGEPPSQVRLGGDNLTLTEG----------EDISIRRVIIHPDYSASTAYNDIALLELETAAK 235
            |           ..|.||:..|          ....:...|.||||::.|..|||.||:|:|..:
Zfish    70 D-----------KDDVLTVVTGAHDLRKKAIYNTFKVTSYIPHPDYNSYTLENDIMLLKLKTKVR 123

  Fly   236 --------------PELKPTCIWTQKEVTNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQ 286
                          .:||          .:||.:..|:|:....|..:.:|.:.....|::.||:
Zfish   124 LSNSVGLISLPRNGEDLK----------ADTLCSIAGWGRLWRKGAKTDRLREAETVIVNDAECE 178

  Fly   287 HHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQG--CASGP-P 348
            ..::.|.:|..::    ||   .|...||.|||||||:..:    ..||||:....  |.|.. |
Zfish   179 RRWESDYVASKMI----CA---YGHGGTCSGDSGGPLVCNN----TAVGITAFSDRYLCKSRLFP 232

  Fly   349 SVYTRVSSFVDWIEGI 364
            .|:.|:|:::.||:.|
Zfish   233 DVFARISAYLPWIQNI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 78/261 (30%)
Tryp_SPc 132..361 CDD:214473 76/258 (29%)
LOC101886682XP_005170582.2 Tryp_SPc 27..248 CDD:238113 76/258 (29%)
Tryp_SPc 27..245 CDD:214473 74/255 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.