DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and CG42694

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:253 Identity:73/253 - (28%)
Similarity:109/253 - (43%) Gaps:45/253 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 GWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGEDISIRRVIIHP 214
            ||.::.....:..|.|:||:..|||:||.|.|:.|:  ..|:||..|.|.:. ...::..|:| |
  Fly    45 GWLAHISNGTHVLCSGSLISKQFVLSAAQCIDVHGK--LFVQLGVSNATKSP-HWYTVSNVVI-P 105

  Fly   215 DYSASTAYNDIALLELETAA--KPELKPTCIWTQKEVTNTL-VTAIGYGQTSFAGLS-SAQLLKV 275
            .:|......||.||:|..:.  ...:.|.||...   |||| :..|....|:.|.|| :.....:
  Fly   106 SHSGKRLQRDIGLLKLSQSVDYNDFVYPICIALN---TNTLDMVKILQNFTTSAWLSKNKNPQTI 167

  Fly   276 PLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLL------------MQDG 328
            .|..:|.:.|     |..|:..|...::||..:. ..::|..|||..|.            |..|
  Fly   168 VLSQLSRDRC-----KLNLSGNVTPKEICAASLQ-RNNSCFIDSGSALTQPIIQGSNIVREMLFG 226

  Fly   329 LLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQ-------VTNAPQPNQ 379
            :.|||.|    ...|:.  |::|..|:..|.|||.:|   ||       ....|:.||
  Fly   227 IRGYVNG----RSWCSE--PAIYIDVAECVGWIETVV---QQYDGTDSRAVATPEVNQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 67/229 (29%)
Tryp_SPc 132..361 CDD:214473 64/226 (28%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 66/228 (29%)
Tryp_SPc 46..253 CDD:214473 63/225 (28%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437514
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.