DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment spirit and si:dkey-78l4.13

DIOPT Version :9

Sequence 1:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster
Sequence 2:XP_003201101.3 Gene:si:dkey-78l4.13 / 100034660 ZFINID:ZDB-GENE-060503-459 Length:253 Species:Danio rerio


Alignment Length:255 Identity:76/255 - (29%)
Similarity:114/255 - (44%) Gaps:55/255 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 VVGGMPTRPREFPFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDN 196
            :|.|...||...|:|.::.....      :.|||.|::..||:|||||.           :.|..
Zfish    25 IVNGNEARPHSRPYMVSVQCNRK------HICGGFLVSEQFVMTAAHCF-----------VNGKE 72

  Fly   197 LTL-------TEGED-ISIRRVIIHPDYSASTAYNDIALLELETAAKPELKPTCIW-----TQKE 248
            ||:       |:|.. :.::...|||.:.:.|..|||.||:|....|...|..  |     ..|:
Zfish    73 LTVVVGAHEYTDGASRMDVKFYHIHPGFESKTLLNDIMLLQLHKKVKKSNKVN--WIPIPNADKD 135

  Fly   249 V-TNTLVTAIGYGQTSFAGLSSAQLLKVPLKSVSNEECQHH----YQKDQLAQGVLGTQMCAGDI 308
            : ..|..:..|:|:.:..|..||:|::|.:.....:.||.:    |...::        ||.|  
Zfish   136 IKAKTKCSVAGWGKNTTHGEVSAKLMEVNVTLFDKKACQKYWGPTYSTSKM--------MCTG-- 190

  Fly   309 TGERDTCQGDSGGPLLMQDGLLGYVVGITSLGQ--GCAS-GPPSVYTRVSSFVDWIEGIV 365
             |....|||||||||:...    ..|||.|..:  .|.| ..|:|||::|.|:.||:.||
Zfish   191 -GHGGFCQGDSGGPLVCDK----VAVGIVSFNEKNNCDSPTKPNVYTQISKFLSWIKCIV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 74/252 (29%)
Tryp_SPc 132..361 CDD:214473 72/249 (29%)
si:dkey-78l4.13XP_003201101.3 Tryp_SPc 25..242 CDD:238113 73/250 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1144875at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.