DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gucy1a2

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_076446.1 Gene:Gucy1a2 / 66012 RGDID:621655 Length:730 Species:Rattus norvegicus


Alignment Length:260 Identity:64/260 - (24%)
Similarity:119/260 - (45%) Gaps:31/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 KKENGLLESILPRKMIRTLQEEICSRIEDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHL 310
            ||...||.||.|    ..:.:::..|.:.|.:.|               .:|::|.:|:|.:|.:
  Rat   486 KKTVDLLYSIFP----GDVAQQLWQRQQVQARKF---------------DDVTMLFSDIVGFTAI 531

  Fly   311 TTTLEAPQLVEILHDLFVNFDLAANRNRAMRIKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIH 375
            .......|::.:|::|:..||.........:::.:||:|...:|:......||......||:|:.
  Rat   532 CAQCTPMQVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVASGLHRKSLCHAKPIALMALKMME 596

  Fly   376 ITQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTL 440
            :::.|.:.....|.:|||:|||.|.||::|....::.::..:|.:.::.||...|..:::|..|.
  Rat   597 LSEEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINISPTTY 661

  Fly   441 SMLDEH----YIFREGTEAAKNDPILQQAGIRTFLVSNRLPDAVEPGELDDELSSASINSCRLSY 501
            .:|...    :|.|...|...|.| .:..|:..||.....|...:|     .|||:.|.  ::||
  Rat   662 QLLKREDSFTFIPRSREELPDNFP-KEIPGVCYFLELRTGPKPPKP-----SLSSSRIK--KVSY 718

  Fly   502  501
              Rat   719  718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 46/201 (23%)
Nucleotidyl_cyc_III 292..445 CDD:299850 38/152 (25%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Gucy1a2NP_076446.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..53
HNOB <157..268 CDD:285002
HNOBA 314..501 CDD:285003 7/18 (39%)
CYCc 483..672 CDD:214485 48/204 (24%)
Guanylate_cyc 512..696 CDD:278633 46/199 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.