DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and NPR2

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:XP_024303324.1 Gene:NPR2 / 4882 HGNCID:7944 Length:1103 Species:Homo sapiens


Alignment Length:303 Identity:84/303 - (27%)
Similarity:125/303 - (41%) Gaps:77/303 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   785 LVLR-ERHVNYLRKFNYFMRVCYEEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYE 848
            |:|| |::.|.|.|.       .||..|...|:.|..:.::..|||..||:..|   ..:.:..|
Human   857 LLLRMEQYANNLEKL-------VEERTQAYLEEKRKAEALLYQILPHSVAEQLK---RGETVQAE 911

  Fly   849 NFSKVAVMFASIENFNADTAG------LRILHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVAC 907
            .|..|.:.|:.|..|.|.:|.      :.:|:::..|||.::.::.. ||:|.|   |..|||..
Human   912 AFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAIIDNFDV-YKVETI---GDAYMVVS 972

  Fly   908 GLETDHYTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMT 972
            ||                                          .|.|..:...::..:|:.::.
Human   973 GL------------------------------------------PGRNGQRHAPEIARMALALLD 995

  Fly   973 EFALDLLRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMS 1037
              |:...||.|        ..:|..   .|:||:..|.|.||||||..|.|.::|.|||.||||.
Human   996 --AVSSFRIRH--------RPHDQL---RLRIGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRME 1047

  Fly  1038 STGLLDNIQVTRHTAKVLRQFN-IRCNYRGHTEVKGVGKVPTY 1079
            |.|....|.|:..|...|.:.. .:...||..|:||.||:.||
Human  1048 SNGQALKIHVSSTTKDALDELGCFQLELRGDVEMKGKGKMRTY 1090

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 64/247 (26%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 66/242 (27%)
NPR2XP_024303324.1 Periplasmic_Binding_Protein_Type_1 26..421 CDD:324556
PK_GC-A_B 521..848 CDD:270944
HNOBA <857..902 CDD:311573 17/51 (33%)
CYCc 881..1065 CDD:214485 64/245 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.