DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and NPR1

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_000897.3 Gene:NPR1 / 4881 HGNCID:7943 Length:1061 Species:Homo sapiens


Alignment Length:299 Identity:85/299 - (28%)
Similarity:120/299 - (40%) Gaps:78/299 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 ERHVNYLRKFNYFMRVCYEEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYENFSKV 853
            |::.|.|.:.       .||..|...|:.|..:.::..|||..||:..|   ..:.:..|.|..|
Human   821 EQYANNLEEL-------VEERTQAYLEEKRKAEALLYQILPHSVAEQLK---RGETVQAEAFDSV 875

  Fly   854 AVMFASIENFNADTAG------LRILHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVACGLETD 912
            .:.|:.|..|.|.:|.      :.:|:::..|||.::.::.. ||:|.|   |..|||..||   
Human   876 TIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDV-YKVETI---GDAYMVVSGL--- 933

  Fly   913 HYTDFSIDIPVKQPEADS-EIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEFAL 976
                     ||:.....: |:.|                                       .||
Human   934 ---------PVRNGRLHACEVAR---------------------------------------MAL 950

  Fly   977 DLLRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGL 1041
            .||..:...|..:...|     ...|:|||..|.|.||||||..|.|.::|.|||.||||.|.|.
Human   951 ALLDAVRSFRIRHRPQE-----QLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGE 1010

  Fly  1042 LDNIQVTRHTAKVLRQF-NIRCNYRGHTEVKGVGKVPTY 1079
            ...|.::..|..||.:| ......||..|:||.|||.||
Human  1011 ALKIHLSSETKAVLEEFGGFELELRGDVEMKGKGKVRTY 1049

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 67/248 (27%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 71/243 (29%)
NPR1NP_000897.3 PBP1_NPR_A 36..443 CDD:107380
ANF_receptor 54..414 CDD:279440
PK_GC-A_B 534..807 CDD:270944
TyrKc 547..801 CDD:197581
HNOBA <816..861 CDD:285003 13/46 (28%)
CYCc 840..1032 CDD:214485 69/254 (27%)
Guanylate_cyc 867..1053 CDD:278633 71/243 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.