DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gyc89Db

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:388 Identity:84/388 - (21%)
Similarity:160/388 - (41%) Gaps:127/388 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 VISLLFVVPGCPLVIKILAGLLILGLHLGTVHLYYGFAFERSETTDLGLKSDYAHT-WYLVALFI 783
            |.||:|:   |..:|:.|..|..:||:|..::.:             ||..:.... |       
  Fly   388 VDSLIFL---CSPLIENLDELHGIGLYLNDLNPH-------------GLSRELVMAGW------- 429

  Fly   784 VLVLRERHVNYLRKFNYFMRVCYEEAHQQTDEKLRSIKI----------IMANILPTHVAQVYKV 838
                  :|.:.|       .:.:|:..|::||..:|:::          ::.:::|..:|:  ::
  Fly   430 ------QHCSKL-------EIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE--RM 479

  Fly   839 RRPHDQLYYENFSKVAVMFASIENF------NADTA--GLRILHEIICCFDDLLVDYQTRYKIEK 895
            |:..:.: .::|.:|:|:|..:.|.      |...|  .:..|:::....|:.::. ...||:|.
  Fly   480 RKSEEHV-CQSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIIS-PFVYKVET 542

  Fly   896 IKVMGWTYMVACGLETDHYTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPY 960
            :   |..||...|                          ...|..:|                  
  Fly   543 V---GMVYMAVSG--------------------------APDVNPLH------------------ 560

  Fly   961 AQVQDVAVLVMTEFALDL-LRIMHDIRYNYVFSEYDTFLTG-SLKIGISHGSVMAGVVGLSKPHY 1023
                       .|.|.|| ||:|..::.:        .|.| ::::||:.|.|:|||||:..|.|
  Fly   561 -----------AEHACDLALRVMKKVKAH--------ALPGVAIRVGINSGPVVAGVVGMKVPRY 606

  Fly  1024 DIWGHTVNMASRMSSTGLLDNIQVTRHTAKVLRQFNIRCNYRGHTEVKGVGKVPTYLVVVDPD 1086
            .::|.|||.||||.|:.....||::.:||..:::...:...||..:|||.|::.||.::..|:
  Fly   607 CLFGDTVNTASRMESSSDPWMIQLSNYTALKVQKVGYKVEARGFVKVKGKGEMETYWLLEGPE 669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 57/261 (22%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 59/245 (24%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 23/128 (18%)
Nucleotidyl_cyc_III 488..665 CDD:416391 59/243 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453928
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.