DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gyc89Da

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_001036718.1 Gene:Gyc89Da / 42001 FlyBaseID:FBgn0038435 Length:667 Species:Drosophila melanogaster


Alignment Length:390 Identity:87/390 - (22%)
Similarity:161/390 - (41%) Gaps:131/390 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   720 VISLLFVVPGCPLVIKILAGLLILGLHLGTVHLYYGFAFERSETTDLGLKSDYAHT-WYLVALFI 783
            |.||:|:   |..:|:.|..|..:||:|..::.:             ||..:.... |       
  Fly   385 VDSLIFL---CSPLIENLDELHGIGLYLNDLNPH-------------GLSRELVMAGW------- 426

  Fly   784 VLVLRERHVNYLRKFNYFMRVCYEEAHQQTDEKLRSIKI----------IMANILPTHVAQVYKV 838
                  :|.:.|       .:.:|:..|::||..:|:::          ::.:::|..:|:  ::
  Fly   427 ------QHCSKL-------EIMFEKEEQRSDELEKSLELADSWKRQGDELLYSMIPRPIAE--RM 476

  Fly   839 RRPHDQLYYENFSKVAVMFASIENFNADTAGL----------RILHEIICCFDDLLVDYQTRYKI 893
            |...:|: .::|.:|:|:|  :|..|....||          ..|:::....|:.::. ...||:
  Fly   477 RLSEEQV-CQSFEEVSVIF--LEVMNVYDEGLNSIQGAMQTVNTLNKVFSALDEEIIS-PFVYKV 537

  Fly   894 EKIKVMGWTYMVACGLETDHYTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQ 958
            |.:   |..||...|                                            ..:|:.
  Fly   538 ETV---GMVYMAVSG--------------------------------------------APDVNP 555

  Fly   959 PYAQ-VQDVAVLVMTEF-ALDLLRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKP 1021
            .:|: ..|:|:.||.:| |.|    |.|:               ::::||:.|.|:|||||...|
  Fly   556 LHAEHACDLALRVMKKFKAHD----MGDV---------------AIRVGINSGPVVAGVVGQKVP 601

  Fly  1022 HYDIWGHTVNMASRMSSTGLLDNIQVTRHTAKVLRQFNIRCNYRGHTEVKGVGKVPTYLVVVDPD 1086
            .|.::|.|||.||||.|:.....||::::|...:||...:...||..:|||.|.:.||.::..|:
  Fly   602 RYCLFGDTVNTASRMESSSDPWKIQLSKYTGDKVRQVGYKVESRGTVQVKGKGDMETYWLLEGPE 666

  Fly  1087  1086
              Fly   667  666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 58/263 (22%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 61/247 (25%)
Gyc89DaNP_001036718.1 HNOB 2..161 CDD:285002
HNOBA 218..476 CDD:285003 23/128 (18%)
CYCc 457..643 CDD:214485 57/257 (22%)
Guanylate_cyc 485..662 CDD:278633 61/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453929
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.