DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and CG31183

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_001287342.1 Gene:CG31183 / 41927 FlyBaseID:FBgn0051183 Length:1417 Species:Drosophila melanogaster


Alignment Length:297 Identity:78/297 - (26%)
Similarity:125/297 - (42%) Gaps:72/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   793 NYLRKFNYF---MRVCYEEAHQQTDEKLRSIKIIMANILPTHVAQVYKVRRPHDQLYYENFSKVA 854
            |.|::...:   :....||..|...|:.:..:.::..:||..||......:|   :..|.|.:|.
  Fly   892 NLLKRMELYANNLEELVEERTQDYHEEKKKCEKLLYQLLPQSVAAQLISGQP---VVAETFDQVT 953

  Fly   855 VMFASIENFNADTAG------LRILHEIICCFDDLLVDYQTRYKIEKIKVMGWTYMVACGLETDH 913
            :.|:.|..|.|.:|.      ::.|:::..|||.::.::.. ||:|.|   |..|||..||    
  Fly   954 IYFSDIVGFTAISAESTPMQVVQFLNDLYTCFDSIVENFDV-YKVETI---GDAYMVVSGL---- 1010

  Fly   914 YTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEFALDL 978
                             .||.|:.                        ..:::|.|     ||.|
  Fly  1011 -----------------PIRNGNQ------------------------HAREIARL-----ALAL 1029

  Fly   979 LRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSSTGLLD 1043
            |..:|:.|.::  ...|..   .|:||:..|:.:||||||..|.|.::|.|||.||||.|.|...
  Fly  1030 LEAVHNFRIHH--RPEDRL---KLRIGLHTGACVAGVVGLKMPRYCLFGDTVNTASRMESNGEAL 1089

  Fly  1044 NIQVTRHTAKVLRQF-NIRCNYRGHTEVKGVGKVPTY 1079
            .|.::..|.:.|.:| ......||...:||.|::.||
  Fly  1090 KIHISETTKEALDEFGTFVTTRRGFVPMKGKGEMLTY 1126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 64/247 (26%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 67/242 (28%)
CG31183NP_001287342.1 PBP1_NPR_like 88..498 CDD:107368
ANF_receptor 108..473 CDD:279440
PK_GC-A_B 589..883 CDD:270944
Pkinase_Tyr 613..877 CDD:285015
HNOBA <893..938 CDD:285003 9/44 (20%)
CYCc 917..1108 CDD:214485 66/252 (26%)
Guanylate_cyc 944..1130 CDD:278633 67/242 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453936
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.