DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and CG10738

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_729905.2 Gene:CG10738 / 39516 FlyBaseID:FBgn0036368 Length:1250 Species:Drosophila melanogaster


Alignment Length:394 Identity:102/394 - (25%)
Similarity:155/394 - (39%) Gaps:99/394 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 GLRRAILSRYQLV---YQNIVYQLV----------MKKENGLLESILPRKMIRTLQEEICSRIED 274
            |:|..|......:   |.|.:..||          .||.:.||..:|||          |  :.|
  Fly   853 GMRPNIFDNMMAMMEKYANNLEALVDDRTDQLQEEKKKTDALLHEMLPR----------C--VAD 905

  Fly   275 QDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRA 339
            |      .|.| .|:..|.|..|||..:|:|.:|.::......|:|:.|:||:..||........
  Fly   906 Q------LKKG-HKVDPEHYEQVSIYFSDIVGFTAMSAECTPLQVVDFLNDLYTCFDSIIGHYDV 963

  Fly   340 MRIKFLGDSYNCVAGIP-NYFPAHASCCVDQALEMIHITQGVSS-----RRELDINLRIGVHSGE 398
            .:::.:||:|..|:|:| .....||:   :.|...:|:...||.     |....:.||||:|||.
  Fly   964 YKVETIGDAYMVVSGLPLRNGDLHAA---EIATMSLHLLSAVSEFKIRHRPTNRLLLRIGIHSGP 1025

  Fly   399 VFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVSQRTLSMLDE------------------ 445
            |.||::|....::.::...|:..:|:||||:|..:|.|.:...:||.                  
  Fly  1026 VCAGVVGLKMPRYCLFGDTVNTASRMESSGVPLKIHCSWQCRQLLDRLGGYHFAERGVISMKGKG 1090

  Fly   446 ----HYIFREGTEA---------------AKNDPI---LQQA-------GIRTFLVSNRLPDAVE 481
                :::..|..||               |.|..|   ::||       |||:.|....||    
  Fly  1091 DQRTYWLLGEDEEARTRRTYERSQRRGSRALNKFIQGTIKQAQEQANEYGIRSSLKQKNLP---- 1151

  Fly   482 PGELDDELSSASINSCRLSYGGYYEEIQIKAQREIMKEVDQMAVGHCFIEWRRSSSMKKQDFNEE 546
            ...|....|..|....|.:.|...|..:..:. |.:.|||.      :...||||....|...||
  Fly  1152 RNSLTRSSSLESPKKLRFAAGSLLEHHRYHSD-EALLEVDS------YTGLRRSSGGSTQSRYEE 1209

  Fly   547 YLFS 550
            ...|
  Fly  1210 TTLS 1213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 61/225 (27%)
Nucleotidyl_cyc_III 292..445 CDD:299850 49/158 (31%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
CG10738NP_729905.2 PBP1_Speract_GC_like 41..441 CDD:107365
ANF_receptor 67..416 CDD:279440
PK_GC-A_B 570..853 CDD:270944 102/394 (26%)
TyrKc 597..847 CDD:197581
HNOBA <862..907 CDD:285003 14/62 (23%)
CYCc 886..1078 CDD:214485 63/213 (30%)
Guanylate_cyc 913..1099 CDD:278633 50/188 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.