DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Phlpp

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:534 Identity:101/534 - (18%)
Similarity:172/534 - (32%) Gaps:203/534 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 LQEEICSRIEDQDKNF---TPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHD 325
            |..|:.:..|:|...|   :|.|..|:...|    ..|||:.   ||.:||........:|:|  
  Fly    28 LPVEVTAAEEEQAATFGQTSPQKLSLKGSQL----GGSILIG---NYNYLTQLEVCENEMEVL-- 83

  Fly   326 LFVNFDLAA---------NRNRAMRIKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQGVS 381
                 ||::         :||:.|.:...|.:...:....||               :|   .:|
  Fly    84 -----DLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNY---------------LH---NIS 125

  Fly   382 SRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLV------------H 434
            :.....:.|::                       :.:||::. ..|.||..|            |
  Fly   126 TTNTHPVPLKL-----------------------QRIDISHN-NFSELPNWVGACASLTAINASH 166

  Fly   435 VSQRTLSMLDEHYIFRE--GTEAAKNDPILQQ--------AGIRTF-LVSNRLPDAVEPGELDDE 488
            .....:::|..:|...|  ..:.|.||  |:|        :.||:. |.||.||      .|.|.
  Fly   167 NRLNNVAVLLRNYRITELVSLDLAYND--LKQLDQFPEGFSSIRSLQLQSNELP------SLPDN 223

  Fly   489 LSSASINSCRLSYGGYYEEIQIKAQREIMKEVDQMAVGHCFIE-----WRRSSSMKKQDFNEEYL 548
            .                                 .||.|..:|     ..:.|::.:.:.|....
  Fly   224 F---------------------------------FAVTHARLETLNVSCNKLSTLPRYEQNNHAA 255

  Fly   549 FSNQI----HLVLGVFRSWKREWEFHN---LPDLMIKYTMLLVLCAG---------LAIMSINLI 597
            ..|..    ||...:|.      ..||   |..|.:.|..:.||.|.         :.::|.|::
  Fly   256 LVNLSLAGNHLNDSIFE------PLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNML 314

  Fly   598 EEATYPDILVLLGILLIL-----LILCI-----LAGYKKLRLQWKKLTPMSQPSCFLSRWL--LR 650
            ::  .|:.:..||.|.:|     |:||.     ||..|.|.|....|..::..:...||.|  |.
  Fly   315 QQ--LPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLD 377

  Fly   651 ISERIEDSLFVRIPLTMVVLLLLYVMSSQAVFSCDVAKLELSIIEAHLYN--------------E 701
            :|..::                |.|...|.......::...|:::....|              :
  Fly   378 LSGNLQ----------------LQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQ 426

  Fly   702 KSYAECFGPWTVTY 715
            ::..:..||||:.:
  Fly   427 RNQNKTSGPWTMGF 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 38/208 (18%)
Nucleotidyl_cyc_III 292..445 CDD:299850 28/173 (16%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/18 (22%)
LRR_8 109..169 CDD:290566 12/101 (12%)
leucine-rich repeat 111..135 CDD:275380 4/41 (10%)
leucine-rich repeat 136..158 CDD:275380 6/45 (13%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 6/26 (23%)
LRR_8 205..266 CDD:290566 16/99 (16%)
leucine-rich repeat 210..230 CDD:275380 9/58 (16%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 37/177 (21%)
leucine-rich repeat 256..276 CDD:275380 4/25 (16%)
LRR_8 279..359 CDD:290566 21/81 (26%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 11/45 (24%)
leucine-rich repeat 349..372 CDD:275380 5/22 (23%)
PP2Cc 461..655 CDD:294085
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.