Sequence 1: | NP_728725.2 | Gene: | CG32305 / 317967 | FlyBaseID: | FBgn0052305 | Length: | 1164 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011530203.1 | Gene: | GUCY1B1 / 2983 | HGNCID: | 4687 | Length: | 662 | Species: | Homo sapiens |
Alignment Length: | 247 | Identity: | 64/247 - (25%) |
---|---|---|---|
Similarity: | 108/247 - (43%) | Gaps: | 56/247 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 249 NGLLESILPRKMIRTLQEEICSRIEDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTT 313
Fly 314 LE----APQLVEILHDLFVNFDLAANRNR---AMRIKFLGDSYNCVAGIPNYFPAHASCCVDQAL 371
Fly 372 EMIHITQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVS 436
Fly 437 QRTLSMLD-----------EH----------------YIFRE--GTEAAKND 459 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32305 | NP_728725.2 | CYCc | 251..449 | CDD:214485 | 57/231 (25%) |
Nucleotidyl_cyc_III | 292..445 | CDD:299850 | 46/170 (27%) | ||
CYCc | 814..1056 | CDD:214485 | |||
Nucleotidyl_cyc_III | 845..1081 | CDD:299850 | |||
GUCY1B1 | XP_011530203.1 | HNOB | 2..166 | CDD:311572 | |
HNOBA | 207..449 | CDD:311573 | 6/14 (43%) | ||
Guanylate_cyc | 455..648 | CDD:306677 | 50/202 (25%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |