DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and GUCY1B1

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:XP_011530203.1 Gene:GUCY1B1 / 2983 HGNCID:4687 Length:662 Species:Homo sapiens


Alignment Length:247 Identity:64/247 - (25%)
Similarity:108/247 - (43%) Gaps:56/247 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 NGLLESILPRKMIRTLQEEICSRIEDQDKNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTT 313
            |.||.|:||..:...|:.          |...|:|.         |.||:||.:.:|.:....:.
Human   434 NRLLYSVLPPSVANELRH----------KRPVPAKR---------YDNVTILFSGIVGFNAFCSK 479

  Fly   314 LE----APQLVEILHDLFVNFDLAANRNR---AMRIKFLGDSYNCVAGIPNYFPAHASCCVDQAL 371
            ..    |.::|.:|:||:..||...:..:   ..:::.:||.|..|:|:|.....||......||
Human   480 HASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLAL 544

  Fly   372 EMIHITQGVSSRRELDINLRIGVHSGEVFAGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVS 436
            :|:.|...|....| .:.:.||:|:|||..|:||....::.::...|::|:|.|::|..|.::||
Human   545 DMMEIAGQVQVDGE-SVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVS 608

  Fly   437 QRTLSMLD-----------EH----------------YIFRE--GTEAAKND 459
            :.|...|.           ||                ::.|:  |||..|.|
Human   609 EYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETKQD 660

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 57/231 (25%)
Nucleotidyl_cyc_III 292..445 CDD:299850 46/170 (27%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
GUCY1B1XP_011530203.1 HNOB 2..166 CDD:311572
HNOBA 207..449 CDD:311573 6/14 (43%)
Guanylate_cyc 455..648 CDD:306677 50/202 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.