DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Npr3

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:XP_006232107.1 Gene:Npr3 / 25339 RGDID:3196 Length:652 Species:Rattus norvegicus


Alignment Length:231 Identity:48/231 - (20%)
Similarity:78/231 - (33%) Gaps:72/231 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   856 MFASIENFNADTAGLRI--LHEIICCFDDLLVDYQTRYKIEKIKVMGWTY---------MVACGL 909
            ||  :|.|: |...|.:  |||:      |...|.   |.:..|::..|:         .|:...
  Rat   467 MF--VEGFH-DAILLYVLALHEV------LRAGYS---KKDGGKIIQQTWNRTFEGIAGQVSIDA 519

  Fly   910 ETDHYTDFSIDIPVKQPEADSEIRRGSSVLTVHFGSTEDDEMSGDNVSQPYAQVQDVAVLVMTEF 974
            ..|.|.|||: :.:...||.::     .|:..:||.....:|. .||..|:..:         :.
  Rat   520 NGDRYGDFSV-VAMTDTEAGTQ-----EVIGDYFGKEGRFKMR-SNVKYPWGSL---------KL 568

  Fly   975 ALDLLRIMHDIRYNYVFSEYDTFLTGSLKIGISHGSVMAGVVGLSKPHYDIWGHTVNMASRMSST 1039
            .:|..||:..              |.|.....|.|...:.|.|:             :...:...
  Rat   569 RIDETRIVEH--------------TNSSPCKSSGGLEESAVTGI-------------VVGALLGA 606

  Fly  1040 GLLDNIQVTRHTAKVLRQFNIRCNYRGHTEVKGVGK 1075
            |||......|      :::.|....|.|.|...:||
  Rat   607 GLLMAFYFFR------KKYRITIERRNHQEESNIGK 636

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485
Nucleotidyl_cyc_III 292..445 CDD:299850
CYCc 814..1056 CDD:214485 42/210 (20%)
Nucleotidyl_cyc_III 845..1081 CDD:299850 48/231 (21%)
Npr3XP_006232107.1 PBP1_NPR_C_like 165..556 CDD:107381 25/106 (24%)
ANF_receptor 182..535 CDD:279440 20/80 (25%)
TM_EphA1 587..618 CDD:214014 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.