DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32305 and Gucy1b2

DIOPT Version :9

Sequence 1:NP_728725.2 Gene:CG32305 / 317967 FlyBaseID:FBgn0052305 Length:1164 Species:Drosophila melanogaster
Sequence 2:NP_001257640.1 Gene:Gucy1b2 / 25206 RGDID:2770 Length:742 Species:Rattus norvegicus


Alignment Length:275 Identity:67/275 - (24%)
Similarity:123/275 - (44%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 ILSRYQLVYQNIVYQLVMKKE----------------NGLLESILPRKMIRTLQEEICSRIEDQD 276
            :|::.:|....:..||..|||                ..||.::||..:...|:|.         
  Rat   401 LLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYAMLPEHVANQLKEG--------- 456

  Fly   277 KNFTPSKAGLRKLFLEPYPNVSILVADMVNYTHLTTTLEAPQLVEILHDLFVNFDLAANRNRAMR 341
                      ||:....:...:||.:|:|.:|::....|..|:|.:|:.::..||...:.:...:
  Rat   457 ----------RKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHDVYK 511

  Fly   342 IKFLGDSYNCVAGIPNYFPAHASCCVDQALEMIHITQGVSSRRELD------INLRIGVHSGEVF 400
            ::.:||:|..|.|:|....:||....:.||.|     .:|::..::      |.:|:|:|:|.|.
  Rat   512 VETIGDAYMVVGGVPVPVESHAQRVANFALGM-----RISAKEVMNPVTGEPIQIRVGIHTGPVL 571

  Fly   401 AGIIGHTKWQFDIWSKDVDITNRLESSGLPGLVHVS---QRTLSMLDEHYIFREGTEAAKNDPI- 461
            ||::|....::.::...|:..:|:||.|||..||:|   .|.|.        .:|.|..:...| 
  Rat   572 AGVVGDKMPRYCLFGDTVNTASRMESHGLPSKVHLSPTAHRALK--------NKGFEIVRRGEIE 628

  Fly   462 LQQAGIRT--FLVSN 474
            ::..|..|  ||:.|
  Rat   629 VKGKGKMTTYFLIQN 643

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32305NP_728725.2 CYCc 251..449 CDD:214485 52/206 (25%)
Nucleotidyl_cyc_III 292..445 CDD:299850 44/161 (27%)
CYCc 814..1056 CDD:214485
Nucleotidyl_cyc_III 845..1081 CDD:299850
Gucy1b2NP_001257640.1 HNOB 2..163 CDD:285002
HNOBA 267..453 CDD:285003 11/51 (22%)
CYCc 432..622 CDD:214485 54/221 (24%)
Guanylate_cyc 459..642 CDD:278633 51/195 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.